5eya/1/1:F/1:G

Sequences

>5eya-a1-m1-cF (length=76) [Search sequence]

PLAEELSCSICLEPFKEPVTTPCGHNFCGSCLNETWAVQGSPYLCPQCRAVYQARPQLHK NTVLCNVVEQFLQADL

>5eya-a1-m1-cG (length=86) [Search sequence]

GSHMAELCPLAEELSCSICLEPFKEPVTTPCGHNFCGSCLNETWAVQGSPYLCPQCRAVY QARPQLHKNTVLCNVVEQFLQADLAR

Structure information

PDB ID	5eya (database links: RCSB PDB PDBe PDBj PDBsum)
Title	TRIM25 RING domain in complex with Ubc13-Ub conjugate
Assembly ID	1
Resolution	2.4Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	63
Sequence identity between the two chains	1.0
PubMed citation	27425606

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	F	G
UniProt accession	Q14258	Q14258
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:5eyaF	BioLiP:5eyaG

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5eya-a1-m1-cF_5eya-a1-m1-cG.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5eya-assembly1.cif.gz