5eyo/2/1:C/2:C

Sequences
>5eyo-a2-m1-cC (length=88) [Search sequence]
HMADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNH
THQQDIDDLKRQNALLEQQVRALEKARS
>5eyo-a2-m2-cC (length=88) [Search sequence]
HMADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNH
THQQDIDDLKRQNALLEQQVRALEKARS
Structure information
PDB ID 5eyo (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of the Max bHLH domain in complex with 5-carboxyl cytosine DNA
Assembly ID 2
Resolution 2.39Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 97
Sequence identity between the two chains 1.0
PubMed citation 27903915
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID C C
UniProt accession P61244 P61244
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:5eyoC BioLiP:5eyoC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5eyo-a2-m1-cC_5eyo-a2-m2-cC.pdb.gz
Full biological assembly
Download: 5eyo-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1an2/1/1:A/2:A 1hlo/1/1:B/1:A 5eyo/1/1:A/2:A

[Back to Home]