5ezu/1/2:B/2:A

Sequences
>5ezu-a1-m2-cB (length=67) [Search sequence]
MAFDISVNASKTINALVYFSTQQNKLVIRNEVNDTHYTVEFDRDKVVDTFISYNRHNDTI
EIRGVLP
>5ezu-a1-m2-cA (length=76) [Search sequence]
MAFDISVNASKTINALVYFSTQQNKLVIRNEVNDTHYTVEFDRDKVVDTFISYNRHNDTI
EIRGVLPEETNIGCAV
Structure information
PDB ID 5ezu (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the N-terminal domain of vaccinia virus immunomodulator A46 in complex with myristic acid.
Assembly ID 1
Resolution 1.55Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 90
Sequence identity between the two chains 1.0
PubMed citation 27973613
Chain information
Chain 1 Chain 2
Model ID 2 2
Chain ID B A
UniProt accession P26672 P26672
Species 10254 (Vaccinia virus WR) 10254 (Vaccinia virus WR)
Function annotation BioLiP:5ezuA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5ezu-a1-m2-cB_5ezu-a1-m2-cA.pdb.gz
Full biological assembly
Download: 5ezu-assembly1.cif.gz
Similar dimers

[Back to Home]