5f3h/2/1:L/1:K

Sequences
>5f3h-a2-m1-cL (length=104) [Search sequence]
FGLDCDESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQAN
PRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
>5f3h-a2-m1-cK (length=105) [Search sequence]
FGLDCDEESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQA
NPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Structure information
PDB ID 5f3h (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of myostatin in complex with humanized RK35 antibody
Assembly ID 2
Resolution 2.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 133
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID L K
UniProt accession O14793 O14793
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5f3h-a2-m1-cL_5f3h-a2-m1-cK.pdb.gz
Full biological assembly
Download: 5f3h-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5f3b/1/1:D/1:C 5f3h/1/1:I/1:J
Other dimers with similar sequences but different poses
  • 5e4g/1/1:A/2:A 3hh2/1/1:A/1:B 3sek/1/1:B/2:B 6mac/1/1:A/2:A 7mrz/1/1:A/2:A
  • [Back to Home]