5fe9/1/1:A/1:B

Sequences

>5fe9-a1-m1-cA (length=109) [Search sequence]

RDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYY VSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLID

>5fe9-a1-m1-cB (length=109) [Search sequence]

RDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYY VSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLID

Structure information

PDB ID	5fe9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of human PCAF bromodomain in complex with compound SL1122 (compound 13)
Assembly ID	1
Resolution	2.35Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	27
Sequence identity between the two chains	1.0
PubMed citation	26731131

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q92831	Q92831
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:5fe9A	BioLiP:5fe9B

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5fe9-a1-m1-cA_5fe9-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5fe9-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

5fdz/1/1:B/1:A 5lvr/1/1:A/1:B