5g5x/1/1:A/2:A

Sequences
>5g5x-a1-m1-cA (length=119) [Search sequence]
MDVMNTEVVTVTPEMTVSEVIDLILKTKHLGFPVVEGERLVGIITLHDIIGVEPEERVGN
IMSREVVAVSPNQSAFEAFKIMSEMGIGRLPVVEHGRVVGIVSRSDLMRIKEILEALEV
>5g5x-a1-m2-cA (length=119) [Search sequence]
MDVMNTEVVTVTPEMTVSEVIDLILKTKHLGFPVVEGERLVGIITLHDIIGVEPEERVGN
IMSREVVAVSPNQSAFEAFKIMSEMGIGRLPVVEHGRVVGIVSRSDLMRIKEILEALEV
Structure information
PDB ID 5g5x (database links: RCSB PDB PDBe PDBj PDBsum)
Title CBS domain tandem of site-2 protease from Archaeoglobus fulgidus in complex with llama Nanobody - nucleotide-bound form
Assembly ID 1
Resolution 2.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 30
Sequence identity between the two chains 1.0
PubMed citation 28502790
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession O29915 O29915
Species 2234 (Archaeoglobus fulgidus) 2234 (Archaeoglobus fulgidus)
Function annotation BioLiP:5g5xA BioLiP:5g5xA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5g5x-a1-m1-cA_5g5x-a1-m2-cA.pdb.gz
Full biological assembly
Download: 5g5x-assembly1.cif.gz

[Back to Home]