5go1/1/1:A/6:A

Sequences
>5go1-a1-m1-cA (length=112) [Search sequence]
SERTFIAVKPDGVQRGLAGEVICRFERKGYKLVALKMLQPSGPIVCMVWEGKNVVKGGRM
LLGATNPADSHPGTIRGDFAVDMGRNVCHGSDSVESAEREIAFWFKADELAC
>5go1-a1-m6-cA (length=112) [Search sequence]
SERTFIAVKPDGVQRGLAGEVICRFERKGYKLVALKMLQPSGPIVCMVWEGKNVVKGGRM
LLGATNPADSHPGTIRGDFAVDMGRNVCHGSDSVESAEREIAFWFKADELAC
Structure information
PDB ID 5go1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structural, Functional characterization and discovery of novel inhibitors of Leishmania amazonensis Nucleoside Diphosphatase Kinase (NDK)
Assembly ID 1
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 51
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 6
Chain ID A A
UniProt accession A0A1Y0DDB3 A0A1Y0DDB3
Species 5659 (Leishmania amazonensis) 5659 (Leishmania amazonensis)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5go1-a1-m1-cA_5go1-a1-m6-cA.pdb.gz
Full biological assembly
Download: 5go1-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3ngr/1/1:A/5:A 3ngr/1/2:A/4:A 3ngr/1/3:A/6:A 5go1/1/2:A/5:A 5go1/1/3:A/4:A
Other dimers with similar sequences but different poses
  • 5go1/1/5:A/6:A 3ngr/1/1:A/2:A 3ngr/1/1:A/3:A 3ngr/1/2:A/3:A 3ngr/1/4:A/5:A 3ngr/1/4:A/6:A 3ngr/1/5:A/6:A 5go1/1/1:A/2:A 5go1/1/1:A/3:A 5go1/1/2:A/3:A 5go1/1/4:A/5:A 5go1/1/4:A/6:A
  • [Back to Home]