5gxg/2/1:B/2:B

Sequences
>5gxg-a2-m1-cB (length=106) [Search sequence]
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKV
PAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
>5gxg-a2-m2-cB (length=106) [Search sequence]
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKV
PAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Structure information
PDB ID 5gxg (database links: RCSB PDB PDBe PDBj PDBsum)
Title High-resolution crystal structure of the electron transfer complex of cytochrome p450cam with putidaredoxin
Assembly ID 2
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 23
Sequence identity between the two chains 1.0
PubMed citation 28223532
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B B
UniProt accession P00259 P00259
Species 303 (Pseudomonas putida) 303 (Pseudomonas putida)
Function annotation BioLiP:5gxgB BioLiP:5gxgB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5gxg-a2-m1-cB_5gxg-a2-m2-cB.pdb.gz
Full biological assembly
Download: 5gxg-assembly2.cif.gz

[Back to Home]