5h5o/1/1:B/1:A

Sequences

>5h5o-a1-m1-cB (length=118) [Search sequence]

HALTAEELAFFARFGRREIAAGQALFERGAVGTQFIVVTGQIDLDFGEDLLKHLGPGEFF GELGLLIGDHARSAGASASVDSRLIELAHDDFQRLVDHDPSVAHFLRRSIVRVVNNEQ

>5h5o-a1-m1-cA (length=120) [Search sequence]

GLHALTAEELAFFARFGRREIAAGQALFERGAVGTQFIVVTGQIDLDFGEDLLKHLGPGE FFGELGLLIGDHARSAGASASVDSRLIELAHDDFQRLVDHDPSVAHFLRRSIVRVVNNEQ

Structure information

PDB ID	5h5o (database links: RCSB PDB PDBe PDBj PDBsum)
Title	A cyclic-GMP-dependent signalling pathway regulates bacterial phytopathogenesis
Assembly ID	1
Resolution	2.122Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	52
Sequence identity between the two chains	1.0
PubMed citation	23881098

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	B0RM05	B0RM05
Species	509169 (Xanthomonas campestris pv. campestris str. B100)	509169 (Xanthomonas campestris pv. campestris str. B100)
Function annotation	BioLiP:5h5oB	BioLiP:5h5oA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5h5o-a1-m1-cB_5h5o-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5h5o-assembly1.cif.gz