5h72/1/1:A/1:B

Sequences
>5h72-a1-m1-cA (length=67) [Search sequence]
TGYQEMFQRVNTRIREFMINELKNHHNEDNVFMLAKNSGIEIAKIEEAPNAVLIPAFVLG
ELEVAFK
>5h72-a1-m1-cB (length=67) [Search sequence]
TGYQEMFQRVNTRIREFMINELKNHHNEDNVFMLAKNSGIEIAKIEEAPNAVLIPAFVLG
ELEVAFK
Structure information
PDB ID 5h72 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the periplasmic domain of FliP
Assembly ID 1
Resolution 2.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 21
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q9WZG2 Q9WZG2
Species 243274 (Thermotoga maritima MSB8) 243274 (Thermotoga maritima MSB8)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5h72-a1-m1-cA_5h72-a1-m1-cB.pdb.gz
Full biological assembly
Download: 5h72-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5h72/1/1:C/1:D 5h72/2/1:E/1:F 5h72/2/1:G/1:H
Other dimers with similar sequences but different poses
  • 5h72/2/1:F/1:H 5h72/1/1:A/1:C 5h72/1/1:B/1:D 5h72/2/1:E/1:G
  • [Back to Home]