5hjs/1/1:A/1:B

Sequences

>5hjs-a1-m1-cA (length=226) [Search sequence]

QLSPEQLGMIEKLVAAQQLRVTPWPSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQ
LSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIF
EFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHD
RLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVH

>5hjs-a1-m1-cB (length=226) [Search sequence]

Structure information

PDB ID	5hjs (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Identification of LXRbeta selective agonists for the treatment of Alzheimer's Disease
Assembly ID	1
Resolution	1.72Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	59
Sequence identity between the two chains	1.0
PubMed citation	27011007

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q13133	Q13133
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:5hjsA	BioLiP:5hjsB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	5hjs-a1-m1-cA_5hjs-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	5hjs-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3ipq/1/1:A/2:A 3ips/1/1:A/1:B 3ipu/1/1:B/1:A 5avi/1/1:C/1:A 5avl/1/1:A/2:A