5hkc/1/1:B/1:A

Sequences
>5hkc-a1-m1-cB (length=112) [Search sequence]
VISRAEIYWADLPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNDALAAMPGNVD
LPATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
>5hkc-a1-m1-cA (length=114) [Search sequence]
MVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNDALAAMPGN
VDLPATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
Structure information
PDB ID 5hkc (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of M. tuberculosis MazF-mt3 T52D-F62D mutant in complex with 8-mer RNA
Assembly ID 1
Resolution 1.68Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 84
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P9WII3 P9WII3
Species 83331 (Mycobacterium tuberculosis CDC1551) 83331 (Mycobacterium tuberculosis CDC1551)
Function annotation BioLiP:5hkcA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5hkc-a1-m1-cB_5hkc-a1-m1-cA.pdb.gz
Full biological assembly
Download: 5hkc-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5hk0/1/1:B/1:A 5hk0/2/1:D/1:C 5hk3/1/1:B/1:A

[Back to Home]