5hkh/1/1:C/1:A

Sequences

>5hkh-a1-m1-cC (length=79) [Search sequence]

SKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPAQ TAGNVFLKHGSELRIIPRD

>5hkh-a1-m1-cA (length=86) [Search sequence]

GAMESKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGI NPAQTAGNVFLKHGSELRIIPRDRVG

Structure information

PDB ID	5hkh (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Ufm1 in complex with UBA5
Assembly ID	1
Resolution	2.55Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	22
Sequence identity between the two chains	1.0
PubMed citation	26929408

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	A
UniProt accession	P61960	P61960
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:5hkhC	BioLiP:5hkhA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5hkh-a1-m1-cC_5hkh-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5hkh-assembly1.cif.gz