5hl8/1/1:D/1:A

Sequences

>5hl8-a1-m1-cD (length=68) [Search sequence]

PLVDRLSALQNILSETPGIRLRALSWDAAGNRLQLDIAAVSSRALEQFTQRAQPRFRVRP GEGQLTLE

>5hl8-a1-m1-cA (length=80) [Search sequence]

HAPLVDRLSALQNILSETPGIRLRALSWDAAGNRLQLDIAAVSSRALEQFTQRAQPRFRV RPGDITKPDGIEGQLTLEEN

Structure information

PDB ID	5hl8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	1.93 Angstrom resolution crystal structure of a pullulanase-specific type II secretion system integral cytoplasmic membrane protein GspL (C-terminal fragment; residues 309-397) from Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Assembly ID	1
Resolution	1.93Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	45
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	A
UniProt accession
Species	484021 (Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044)	484021 (Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5hl8-a1-m1-cD_5hl8-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5hl8-assembly1.cif.gz