5ht7/1/1:B/1:C

Sequences

>5ht7-a1-m1-cB (length=82) [Search sequence]

AVLFADANQRGVHKHIFESDADVGADIAFNATPRSMVVLSGVWRLYREPNFQSPYEAEFG PGIYPSIADYGINVIGSMKRIS

>5ht7-a1-m1-cC (length=82) [Search sequence]

AVLFADANQRGVHKHIFESDADVGADIAFNATPRSMVVLSGVWRLYREPNFQSPYEAEFG PGIYPSIADYGINVIGSMKRIS

Structure information

PDB ID	5ht7 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a transition-metal-ion-binding betagamma-crystallin from Methanosaeta thermophila
Assembly ID	1
Resolution	1.862Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	22
Sequence identity between the two chains	1.0
PubMed citation	28029780

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	C
UniProt accession	A0B567	A0B567
Species	349307 (Methanothrix thermoacetophila PT)	349307 (Methanothrix thermoacetophila PT)
Function annotation	BioLiP:5ht7B	BioLiP:5ht7C

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5ht7-a1-m1-cB_5ht7-a1-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5ht7-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

5ht7/1/1:A/1:B 5ht7/1/1:A/1:C