5ht7/1/1:B/1:C

Sequences
>5ht7-a1-m1-cB (length=82) [Search sequence]
AVLFADANQRGVHKHIFESDADVGADIAFNATPRSMVVLSGVWRLYREPNFQSPYEAEFG
PGIYPSIADYGINVIGSMKRIS
>5ht7-a1-m1-cC (length=82) [Search sequence]
AVLFADANQRGVHKHIFESDADVGADIAFNATPRSMVVLSGVWRLYREPNFQSPYEAEFG
PGIYPSIADYGINVIGSMKRIS
Structure information
PDB ID 5ht7 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of a transition-metal-ion-binding betagamma-crystallin from Methanosaeta thermophila
Assembly ID 1
Resolution 1.862Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 22
Sequence identity between the two chains 1.0
PubMed citation 28029780
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession A0B567 A0B567
Species 349307 (Methanothrix thermoacetophila PT) 349307 (Methanothrix thermoacetophila PT)
Function annotation BioLiP:5ht7B BioLiP:5ht7C
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5ht7-a1-m1-cB_5ht7-a1-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 5ht7-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5ht7/1/1:A/1:B 5ht7/1/1:A/1:C

[Back to Home]