5hud/1/1:G/1:H

Sequences
>5hud-a1-m1-cG (length=83) [Search sequence]
PLSDAEIQKYREEINRLDREILDAVKRRTKISQTIGKTRMSSGGTRLVHTREVAIINQFR
EEIGEEGPALAGILLRMGRGKLG
>5hud-a1-m1-cH (length=83) [Search sequence]
PLSDAEIQKYREEINRLDREILDAVKRRTKISQTIGKTRMSSGGTRLVHTREVAIINQFR
EEIGEEGPALAGILLRMGRGKLG
Structure information
PDB ID 5hud (database links: RCSB PDB PDBe PDBj PDBsum)
Title Non-covalent complex of and DAHP synthase and chorismate mutase from Corynebacterium glutamicum with bound transition state analog
Assembly ID 1
Resolution 2.15Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 103
Sequence identity between the two chains 1.0
PubMed citation 29178787
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID G H
UniProt accession Q8NS29 Q8NS29
Species 1718 (Corynebacterium glutamicum) 1718 (Corynebacterium glutamicum)
Function annotation BioLiP:5hudG BioLiP:5hudH
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5hud-a1-m1-cG_5hud-a1-m1-cH.pdb.gz
Full biological assembly
Download: 5hud-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5hub/1/1:A/2:A 5hud/1/1:F/1:E

[Back to Home]