5i0m/2/1:C/1:B

Sequences

>5i0m-a2-m1-cC (length=118) [Search sequence]

PPTNAERLHEFHRAIGAATPERPTPPPPELLRLRQTLLDEESAEVRAEIDHLLARQAAGE ALSAGDLAPLAHALADLLYVTYGALDQLGIDADAVFAEVHRANLSPADVRGVIERLQH

>5i0m-a2-m1-cB (length=137) [Search sequence]

PPTNAERLHEFHRAIGATPERPTPPPPELLRLRQTLLDEESAEVRAEIDHLLARQAAGEA LSAGDLAPLAHALADLLYVTYGALDQLGIDADAVFAEVHRANLSKASGPRRADGKQLKPE GWRPADVRGVIERLQHA

Structure information

PDB ID	5i0m (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of DR2231_E79A mutant in complex with dUMP
Assembly ID	2
Resolution	2.15Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	209
Sequence identity between the two chains	0.992
PubMed citation	27739259

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	B
UniProt accession	Q9RS96	Q9RS96
Species	1299 (Deinococcus radiodurans)	1299 (Deinococcus radiodurans)
Function annotation	BioLiP:5i0mC	BioLiP:5i0mB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5i0m-a2-m1-cC_5i0m-a2-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5i0m-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

2yeu/1/1:B/1:A 2yeu/2/1:C/1:D 2yeu/3/1:F/1:E 2yf3/1/1:B/1:A 2yf3/2/1:C/1:D 2yf3/3/1:F/1:E 2yf4/1/1:B/1:A 2yf4/2/1:C/1:D 2yf4/3/1:F/1:E 2yf9/1/1:A/2:A 2yfc/1/1:B/1:A 2yfc/2/1:D/1:C 2yfd/1/1:D/1:C 2yfd/2/1:B/1:A 5hva/1/1:C/1:A 5hva/2/1:D/1:B 5hwu/1/1:B/1:A 5hx1/1/1:C/1:A 5hx1/2/1:D/1:B 5i0j/1/1:D/1:A 5i0j/2/1:C/1:B 5i0m/1/1:D/1:A