5i1s/1/1:A/1:B

Sequences
>5i1s-a1-m1-cA (length=34) [Search sequence]
LSDEDFKAVFGMTRSAFANLPLWKQQHLKEKGLF
>5i1s-a1-m1-cB (length=34) [Search sequence]
LSDEDFKAVFGMTRSAFANLPLWKQQHLKEKGLF
Structure information
PDB ID 5i1s (database links: RCSB PDB PDBe PDBj PDBsum)
Title Villin headpiece subdomain with a Lys30 to APC substitution
Assembly ID 1
Resolution 1.12Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 12
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession P02640 P02640
Species 9031 (Gallus gallus) 9031 (Gallus gallus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5i1s-a1-m1-cA_5i1s-a1-m1-cB.pdb.gz
Full biological assembly
Download: 5i1s-assembly1.cif.gz

[Back to Home]