5i5a/3/1:A/2:A

Sequences
>5i5a-a3-m1-cA (length=35) [Search sequence]
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC
>5i5a-a3-m2-cA (length=35) [Search sequence]
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC
Structure information
PDB ID 5i5a (database links: RCSB PDB PDBe PDBj PDBsum)
Title quasi racemic structure of allo-Ile7-ShK and D-ShK
Assembly ID 3
Resolution 1.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 20
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P29187 P29187
Species 6123 (Stichodactyla helianthus) 6123 (Stichodactyla helianthus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5i5a-a3-m1-cA_5i5a-a3-m2-cA.pdb.gz
Full biological assembly
Download: 5i5a-assembly3.cif.gz

[Back to Home]