5i5c/1/1:C/1:A

Sequences
>5i5c-a1-m1-cC (length=33) [Search sequence]
RSCIDTIPKSRCTAFCKHSMKYRLSFCRKCGTC
>5i5c-a1-m1-cA (length=34) [Search sequence]
RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKCGTC
Structure information
PDB ID 5i5c (database links: RCSB PDB PDBe PDBj PDBsum)
Title X-ray crystal structure of allo-Thr31-ShK
Assembly ID 1
Resolution 1.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 20
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C A
UniProt accession P29187 P29187
Species 6123 (Stichodactyla helianthus) 6123 (Stichodactyla helianthus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5i5c-a1-m1-cC_5i5c-a1-m1-cA.pdb.gz
Full biological assembly
Download: 5i5c-assembly1.cif.gz
Similar dimers

[Back to Home]