5i7c/2/1:D/1:C

Sequences
>5i7c-a2-m1-cD (length=58) [Search sequence]
HDCAKVDLENAELRRKLIRTKRAFEDTYEKLRMANKAKAQVEKDIKNQILKTHNVLRN
>5i7c-a2-m1-cC (length=59) [Search sequence]
HDCAKVDLENAELRRKLIRTKRAFEDTYEKLRMANKAKAQVEKDIKNQILKTHNVLRNV
Structure information
PDB ID 5i7c (database links: RCSB PDB PDBe PDBj PDBsum)
Title Centrosomin-motif 2 (CM2) domain of Drosophila melanogaster Centrosomin (Cnn)
Assembly ID 2
Resolution 2.804Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 29
Sequence identity between the two chains 1.0
PubMed citation 28575671
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D C
UniProt accession P54623 P54623
Species 7227 (Drosophila melanogaster) 7227 (Drosophila melanogaster)
Function annotation BioLiP:5i7cD BioLiP:5i7cC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5i7c-a2-m1-cD_5i7c-a2-m1-cC.pdb.gz
Full biological assembly
Download: 5i7c-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 5mw0/1/1:B/1:A 5mvw/1/1:A/1:B 5mw9/2/1:E/1:F 5mwe/1/1:A/1:B
  • [Back to Home]