5ie9/1/1:D/1:A

Sequences

>5ie9-a1-m1-cD (length=92) [Search sequence]

MEAKTMKDMQKEVDAYIGQFKEGYFSPLAMMARLTEEMGELAREVNHYYGSIEEELGDVL FVMICMANSLNIDLETAHNIVMNKFNTRDKDR

>5ie9-a1-m1-cA (length=94) [Search sequence]

MEAKTMKDMQKEVDAYIGQFKEGYFSPLAMMARLTEEMGELAREVNHYYGERSIEEELGD VLFVMICMANSLNIDLETAHNIVMNKFNTRDKDR

Structure information

PDB ID	5ie9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the Bacillus-conserved MazG protein, a nucleotide pyrophosphohydrolase
Assembly ID	1
Resolution	2.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	42
Sequence identity between the two chains	1.0
PubMed citation	26920050

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	A
UniProt accession	Q813T0	Q813T0
Species	1396 (Bacillus cereus)	1396 (Bacillus cereus)
Function annotation	BioLiP:5ie9D	BioLiP:5ie9A

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5ie9-a1-m1-cD_5ie9-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5ie9-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

5ie9/1/1:D/1:C 5ie9/1/1:A/1:B 5ie9/1/1:D/1:B 5ie9/1/1:A/1:C