5ifz/1/1:B/1:A

Sequences

>5ifz-a1-m1-cB (length=117) [Search sequence]

MKVAVAGDSAGEGLAKVLADHLKDRFEVSEISNLSDRVASAVLDGTYDRAILVCGTGIGV CIAANKVPGIRAALTHDTYSAERAALSNNAQIITMGARVIGAEVAKTIADAFLAQTF

>5ifz-a1-m1-cA (length=118) [Search sequence]

MKVAVAGDSAGEGLAKVLADHLKDRFEVSEISNLSDRVASAVLDGTYDRAILVCGTGIGV CIAANKVPGIRAALTHDTYSAERAALSNNAQIITMGARVIGAEVAKTIADAFLAQTFD

Structure information

PDB ID	5ifz (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of Ribose-5-phosphate Isomerase from Brucella melitensis 16M
Assembly ID	1
Resolution	1.6Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	71
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q8YCV4	Q8YCV4
Species	224914 (Brucella melitensis bv. 1 str. 16M)	224914 (Brucella melitensis bv. 1 str. 16M)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5ifz-a1-m1-cB_5ifz-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5ifz-assembly1.cif.gz