5ig2/3/1:C/1:B

Sequences

>5ig2-a3-m1-cC (length=279) [Search sequence]

MFEFDGKVAVITGAGSGFGRAFAEKGASLGMKLVLADVDEGALARTVDTLRAAGAEVIGV
RTDVSNGAQVQALADAALEAFGKVHLLFNNAGVGAGGFLWESSANDWAWVFGVNVMGVAH
GVRVFAPIMLGQNEAAHIVNTASVAGLLSPPSMGIYNASKHAVVSLTETLYHDLRNAGGE
VGCSLLCPAFVPTGIADAERVRPEALRNEAQPTRSQLAADRQLQRAVRSGKLGATDVATL
TFEAIAERRFYILTHPAILATVRLRHEDIELQRNPTDPL

>5ig2-a3-m1-cB (length=281) [Search sequence]

Structure information

PDB ID	5ig2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of a short chain dehydrogenase/reductase SDR from Burkholderia phymatum in complex with NAD
Assembly ID	3
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	203
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	B
UniProt accession	B2JGP2	B2JGP2
Species	391038 (Paraburkholderia phymatum STM815)	391038 (Paraburkholderia phymatum STM815)
Function annotation	BioLiP:5ig2C	BioLiP:5ig2B

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	5ig2-a3-m1-cC_5ig2-a3-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	5ig2-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures	5ig2/1/1:A/2:A 5ig2/1/1:C/1:B 5ig2/1/2:C/2:B 5ig2/2/1:A/2:A
Other dimers with similar sequences but different poses	5ig2/1/2:A/2:B 5ig2/1/1:A/1:B