5igm/1/1:B/1:A

Sequences
>5igm-a1-m1-cB (length=112) [Search sequence]
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKS
VTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSM
>5igm-a1-m1-cA (length=113) [Search sequence]
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKS
VTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKERLLALKRSMS
Structure information
PDB ID 5igm (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the bromodomain of human BRD9 in complex with bromosporine (BSP)
Assembly ID 1
Resolution 1.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 50
Sequence identity between the two chains 1.0
PubMed citation 27757418
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession Q9H8M2 Q9H8M2
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:5igmB BioLiP:5igmA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5igm-a1-m1-cB_5igm-a1-m1-cA.pdb.gz
Full biological assembly
Download: 5igm-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3hme/1/1:A/1:B 5ign/1/1:A/1:B 5twx/5/1:B/1:A 5twx/5/1:C/1:D 6v0s/1/1:A/2:B 6v1b/3/2:B/1:A
Other dimers with similar sequences but different poses
  • 5twx/5/1:D/1:B 5twx/5/1:C/1:A
  • [Back to Home]