5ip2/1/1:C/1:B

Sequences

>5ip2-a1-m1-cC (length=229) [Search sequence]

SKVKLTKENIVALLTQGKDLEFNFKTFCLENLDQIKKMSIISCLTFLKNRQSIMKVIKQS
DFTFGKITIKKTSDRIGATDMTFRRLDSLIRVRLVEETGNSENLNTIKSKIASHPLIQAY
GLPLDDAKSVRLAIMLGGSLPLIASVDSFEMISVVLAIYQDAKYKDLGIDPKKYDTKEAL
GKVCTVLKSKAFEMNEDQVKKGKEYAAILSSSNSVAMEHYSETLNKFYE

>5ip2-a1-m1-cB (length=233) [Search sequence]

Structure information

PDB ID	5ip2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Tomato spotted wilt tospovirus nucleocapsid protein-ssRNA complex
Assembly ID	1
Resolution	3.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	103
Sequence identity between the two chains	1.0
PubMed citation	28768868

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	B
UniProt accession	F4ZD19	F4ZD19
Species
Function annotation	BioLiP:5ip2C	BioLiP:5ip2B

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	5ip2-a1-m1-cC_5ip2-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	5ip2-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	5ip1/1/1:A/1:B 5ip2/1/1:A/1:B 5ip3/1/1:A/1:B
Other dimers with similar sequences but different poses	5ip1/1/1:A/1:C 5ip2/1/1:A/1:C