5iqq/1/1:D/1:C

Sequences

>5iqq-a1-m1-cD (length=81) [Search sequence]

AAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVP YAMNLLNGIKLYGRPIKIQFR

>5iqq-a1-m1-cC (length=83) [Search sequence]

AAAAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVS VPYAMNLLNGIKLYGRPIKIQFR

Structure information

PDB ID	5iqq (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the human RBM7 RRM domain
Assembly ID	1
Resolution	2.52Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	18
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	C
UniProt accession	Q9Y580	Q9Y580
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5iqq-a1-m1-cD_5iqq-a1-m1-cC.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5iqq-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

5iqq/1/1:B/1:A 5iqq/1/1:B/1:C 5iqq/1/1:E/1:A 5iqq/1/1:E/1:D