5itm/1/1:F/1:B

Sequences
>5itm-a1-m1-cF (length=46) [Search sequence]
VEEIVKVSRNYQVTIPAKVRQKFQIKEGDLVKVTFDESEGVVKIQL
>5itm-a1-m1-cB (length=47) [Search sequence]
AVEEIVKVSRNYQVTIPAKVRQKFQIKEGDLVKVTFDESEGVVKIQL
Structure information
PDB ID 5itm (database links: RCSB PDB PDBe PDBj PDBsum)
Title The structure of truncated histone-like protein
Assembly ID 1
Resolution 1.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 10
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID F B
UniProt accession A0A0E3K9N8 A0A0E3K9N8
Species 2287 (Saccharolobus solfataricus) 2287 (Saccharolobus solfataricus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5itm-a1-m1-cF_5itm-a1-m1-cB.pdb.gz
Full biological assembly
Download: 5itm-assembly1.cif.gz

[Back to Home]