5itm/3/1:C/1:D

Sequences
>5itm-a3-m1-cC (length=47) [Search sequence]
AVEEIVKVSRNYQVTIPAKVRQKFQIKEGDLVKVTFDESEGVVKIQL
>5itm-a3-m1-cD (length=47) [Search sequence]
AVEEIVKVSRNYQVTIPAKVRQKFQIKEGDLVKVTFDESEGVVKIQL
Structure information
PDB ID 5itm (database links: RCSB PDB PDBe PDBj PDBsum)
Title The structure of truncated histone-like protein
Assembly ID 3
Resolution 1.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 148
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession A0A0E3K9N8 A0A0E3K9N8
Species 2287 (Saccharolobus solfataricus) 2287 (Saccharolobus solfataricus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5itm-a3-m1-cC_5itm-a3-m1-cD.pdb.gz
Full biological assembly
Download: 5itm-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 2l66/1/1:A/1:B 5itj/1/1:A/1:B 5itm/1/1:A/1:B 5itm/1/1:C/1:D 5itm/2/1:A/1:B

[Back to Home]