5izn/1/1:D/1:B

Sequences
>5izn-a1-m1-cD (length=89) [Search sequence]
KFEAVVRTELGKGASRRLRLAGQFPAVVYGGEAAPVAVALNHDDIVNQDKPEFYEAITLV
IGGEEVKVKPQDVQRHAFKPKVEHDFIRI
>5izn-a1-m1-cB (length=91) [Search sequence]
NAKFEAVVRTELGKGASRRLRLAGQFPAVVYGGEAAPVAVALNHDDIVNQDKPEFYEAIT
LVIGGEEVKVKPQDVQRHAFKPKVEHDFIRI
Structure information
PDB ID 5izn (database links: RCSB PDB PDBe PDBj PDBsum)
Title The crystal structure of 50S ribosomal protein L25 from Vibrio vulnificus CMCP6
Assembly ID 1
Resolution 2.35Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 30
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D B
UniProt accession Q8D8W6 Q8D8W6
Species 216895 (Vibrio vulnificus CMCP6) 216895 (Vibrio vulnificus CMCP6)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5izn-a1-m1-cD_5izn-a1-m1-cB.pdb.gz
Full biological assembly
Download: 5izn-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5izn/1/1:C/1:A 5izn/2/1:F/1:G 5izn/2/1:H/1:E
Other dimers with similar sequences but different poses
  • 5izn/2/1:F/1:E 5izn/1/1:A/1:B
  • 5izn/1/1:D/1:A 5izn/1/1:C/1:B 5izn/2/1:E/1:G 5izn/2/1:F/1:H
  • [Back to Home]