5j6p/2/1:C/2:C

Sequences
>5j6p-a2-m1-cC (length=100) [Search sequence]
QPSVFQCKKCFQIVGDSNAWVISHREYLSFTLSDAVENSVRVEDTFKRSDDGLCVYSELS
CTRCNEVIGKVYNSTPIYLDDIRDMYTFSMDKLQAYQLGN
>5j6p-a2-m2-cC (length=100) [Search sequence]
QPSVFQCKKCFQIVGDSNAWVISHREYLSFTLSDAVENSVRVEDTFKRSDDGLCVYSELS
CTRCNEVIGKVYNSTPIYLDDIRDMYTFSMDKLQAYQLGN
Structure information
PDB ID 5j6p (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Mis18(17-118) from Schizosaccharomyces pombe
Assembly ID 2
Resolution 2.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 41
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID C C
UniProt accession Q9P802 Q9P802
Species 284812 (Schizosaccharomyces pombe 972h-) 284812 (Schizosaccharomyces pombe 972h-)
Function annotation BioLiP:5j6pC BioLiP:5j6pC
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5j6p-a2-m1-cC_5j6p-a2-m2-cC.pdb.gz
Full biological assembly
Download: 5j6p-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5hj0/1/1:A/1:B 5hj0/2/1:C/2:C 5j6p/1/1:A/1:B

[Back to Home]