5j9i/4/1:G/1:H

Sequences

>5j9i-a4-m1-cG (length=65) [Search sequence]

ISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVPNGQAVTLLKLVQRHPETLS HIAEL

>5j9i-a4-m1-cH (length=68) [Search sequence]

ELNISPDEIVSIREQFNMSRGVFARLLHTSSRTLENWEQGRSVPNGQAVTLLKLVQRHPE TLSHIAEL

Structure information

PDB ID	5j9i (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the HigA2 antitoxin C-terminal domain
Assembly ID	4
Resolution	1.797Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	62
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	G	H
UniProt accession	Q9KMA5	Q9KMA5
Species	666 (Vibrio cholerae)	666 (Vibrio cholerae)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5j9i-a4-m1-cG_5j9i-a4-m1-cH.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5j9i-assembly4.cif.gz

Similar dimers

Other dimers with similar sequences and structures	5j9i/1/1:A/1:B 5j9i/2/1:D/1:C 5j9i/3/1:E/1:F 5jaa/1/1:B/1:A
Other dimers with similar sequences but different poses	8a0w/1/1:A/1:B 8a0x/1/1:A/1:B