5jdj/1/1:L/1:A

Sequences
>5jdj-a1-m1-cL (length=90) [Search sequence]
AMETLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQ
LIIMNTSTEDSAEYTFVCGNDQVSATLTVT
>5jdj-a1-m1-cA (length=91) [Search sequence]
GAMETLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLH
QLIIMNTSTEDSAEYTFVCGNDQVSATLTVT
Structure information
PDB ID 5jdj (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of domain I10 from titin in space group P212121
Assembly ID 1
Resolution 1.738Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 40
Sequence identity between the two chains 1.0
PubMed citation 27683155
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID L A
UniProt accession Q8WZ42 Q8WZ42
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:5jdjL
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5jdj-a1-m1-cL_5jdj-a1-m1-cA.pdb.gz
Full biological assembly
Download: 5jdj-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5jdj/2/1:P/1:B 5jdj/3/1:M/1:C 5jdj/4/1:E/1:D 5jdj/5/1:N/1:F 5jdj/6/1:J/1:G 5jdj/7/1:H/1:I 5jdj/8/1:O/1:K

[Back to Home]