5jer/5/1:E/1:G

Sequences

>5jer-a5-m1-cE (length=234) [Search sequence]

ENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDP
GMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPD
GEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKVV
PTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQ

>5jer-a5-m1-cG (length=234) [Search sequence]

Structure information

PDB ID	5jer (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Structure of Rotavirus NSP1 bound to IRF-3
Assembly ID	5
Resolution	2.913Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	16
Sequence identity between the two chains	1.0
PubMed citation	27302953

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	G
UniProt accession	Q14653	Q14653
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:5jerE	BioLiP:5jerG

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	5jer-a5-m1-cE_5jer-a5-m1-cG.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	5jer-assembly5.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

5jel/2/1:A/2:A 5jej/1/1:B/1:A 5jem/1/1:A/1:B 5jem/2/1:G/1:E 5jeo/2/1:A/2:A 5jer/5/1:A/1:E 5jer/5/1:C/1:G 7jfl/1/1:A/1:B