5jge/2/1:D/1:E

Sequences
>5jge-a2-m1-cD (length=30) [Search sequence]
GPHMLDNFMKQLLKLEESLNKLELEQKVTN
>5jge-a2-m1-cE (length=30) [Search sequence]
GPHMLDNFMKQLLKLEESLNKLELEQKVTN
Structure information
PDB ID 5jge (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Atg19 coiled-coil complexed with Ape1 propeptide
Assembly ID 2
Resolution 1.91Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 23
Sequence identity between the two chains 1.0
PubMed citation 27320913
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D E
UniProt accession P35193 P35193
Species 559292 (Saccharomyces cerevisiae S288C) 559292 (Saccharomyces cerevisiae S288C)
Function annotation BioLiP:5jgeD BioLiP:5jgeE
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5jge-a2-m1-cD_5jge-a2-m1-cE.pdb.gz
Full biological assembly
Download: 5jge-assembly2.cif.gz

[Back to Home]