5jla/1/1:C/1:D

Sequences

>5jla-a1-m1-cC (length=258) [Search sequence]

ASAEFNGAIAVVTGAGSGIGRACAELLSRSGANVIVADRDIEAATRVARATGGKTLVLDV
GEDASVTAAANEVRARYGVADVLVNCAGVLQRTLPPGELAQREWDVVSRIDLRGTYLCCA
AFGAPMADRRRGSIVNIASVAGMRSGPLHAYGPAKAGVISLTETLAGEWGPKGVRVNCVS
PGFTQTPALERGFTTHTLKADVLRDAAALGHIVSANEIAEAVVFLASERASAITGVNLPV
DAGYLIAGSWAAYGGLRR

>5jla-a1-m1-cD (length=259) [Search sequence]

Structure information

PDB ID	5jla (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of Ribose-5-phosphate Isomerase from Brucella melitensis 16M
Assembly ID	1
Resolution	1.45Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	120
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q13GR0	Q13GR0
Species	266265 (Paraburkholderia xenovorans LB400)	266265 (Paraburkholderia xenovorans LB400)
Function annotation	BioLiP:5jlaC	BioLiP:5jlaD

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	5jla-a1-m1-cC_5jla-a1-m1-cD.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	5jla-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

5jla/1/1:B/1:D 5jla/1/1:A/1:C

5jla/1/1:A/1:D 5jla/1/1:B/1:C