5jtr/1/1:E/1:F

Sequences
>5jtr-a1-m1-cE (length=40) [Search sequence]
KGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDV
>5jtr-a1-m1-cF (length=40) [Search sequence]
KGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDV
Structure information
PDB ID 5jtr (database links: RCSB PDB PDBe PDBj PDBsum)
Title The structure of chaperone SecB in complex with unstructured MBP binding site e
Assembly ID 1
Resolution Not applicable
Method of structure determination SOLUTION NMR
Number of inter-chain contacts 32
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E F
UniProt accession P0AEY0 P0AEY0
Species 83334 (Escherichia coli O157:H7) 83334 (Escherichia coli O157:H7)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5jtr-a1-m1-cE_5jtr-a1-m1-cF.pdb.gz
Full biological assembly
Download: 5jtr-assembly1.cif.gz

[Back to Home]