5jwr/2/1:G/1:H

Sequences
>5jwr-a2-m1-cG (length=133) [Search sequence]
VDPQHRLSQKLKERLGYLGVYYKRDTAFFFRRMSPADKRKLLDELRSIYRTIVLEYFNTD
AKVNERIDEFVSKAFFADISVSQVLEIHVELMDTFSKQLKLEGRSEDILLDYRLTLIDVI
AHLSEMYRRSIPR
>5jwr-a2-m1-cH (length=133) [Search sequence]
NVDPQHRLSQKLKERLGYLGVYYKRDTAFFFRRMSPADKRKLLDELRSIYRTIVLEYFNT
KVNERIDEFVSKAFFADISVSQVLEIHVELMDTFSKQLKLEGRSEDILLDYRLTLIDVIA
HLSEMYRRSIPRE
Structure information
PDB ID 5jwr (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of foldswitch-stabilized KaiB in complex with the N-terminal CI domain of KaiC and a dimer of KaiA C-terminal domains from Thermosynechococcus elongatus
Assembly ID 2
Resolution 2.61Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 94
Sequence identity between the two chains 0.985
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID G H
UniProt accession Q79V62 Q79V62
Species 197221 (Thermosynechococcus vestitus BP-1) 197221 (Thermosynechococcus vestitus BP-1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5jwr-a2-m1-cG_5jwr-a2-m1-cH.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 5jwr-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1v2z/1/1:A/2:A 5jwr/1/1:E/1:F
Other dimers with similar sequences but different poses
  • 1q6b/1/1:A/1:B 1q6a/1/1:A/1:B 1suy/1/1:A/1:B 1sv1/1/1:A/1:B
    		•

    [Back to Home]