5jx4/1/1:A/1:B

Sequences

>5jx4-a1-m1-cA (length=65) [Search sequence]

HMQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGFKTLEEGQEVSFEIVQGNRGPQAA NVVKL

>5jx4-a1-m1-cB (length=66) [Search sequence]

GHMQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGFKTLEEGQEVSFEIVQGNRGPQA ANVVKL

Structure information

PDB ID	5jx4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of E36-G37del mutant of the Bacillus caldolyticus cold shock protein.
Assembly ID	1
Resolution	1.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	13
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P41016	P41016
Species	1394 ([Bacillus] caldolyticus)	1394 ([Bacillus] caldolyticus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5jx4-a1-m1-cA_5jx4-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5jx4-assembly1.cif.gz