5k89/2/1:H/3:H

Sequences
>5k89-a2-m1-cH (length=89) [Search sequence]
MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLVDAVDKVMKELDEN
GDGEVDFQEYVVLVAALTVACNNFFWENS
>5k89-a2-m3-cH (length=89) [Search sequence]
MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLVDAVDKVMKELDEN
GDGEVDFQEYVVLVAALTVACNNFFWENS
Structure information
PDB ID 5k89 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of Human Calcium-Bound S100A1
Assembly ID 2
Resolution 2.249Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 84
Sequence identity between the two chains 1.0
PubMed citation 28368280
Chain information
Chain 1 Chain 2
Model ID 1 3
Chain ID H H
UniProt accession P23297 P23297
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:5k89H BioLiP:5k89H
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5k89-a2-m1-cH_5k89-a2-m3-cH.pdb.gz
Full biological assembly
Download: 5k89-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 1zfs/1/1:A/1:B 2k2f/1/1:A/1:B 2kbm/1/1:A/1:B 2lp2/1/1:A/1:B 2lp3/1/1:A/1:B 2lux/1/1:A/1:B
Other dimers with similar sequences but different poses
  • 2llt/1/1:A/1:B 2l0p/1/1:A/1:B 2lhl/1/1:A/1:B 2lls/1/1:A/1:B 2llu/1/1:A/1:B 2m3w/1/1:A/1:B
  • [Back to Home]