5kc1/2/1:H/1:F

Sequences
>5kc1-a2-m1-cH (length=53) [Search sequence]
MKINLRLEQFKKELVLYEQKKFKEYGMKIDEITKENKKLANEIGRLRERWDSL
>5kc1-a2-m1-cF (length=61) [Search sequence]
KNSEMKINLRLEQFKKELVLYEQKKFKEYGMKIDEITKENKKLANEIGRLRERWDSLVES
A
Structure information
PDB ID 5kc1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the C-terminal dimerization domain of Atg38
Assembly ID 2
Resolution 2.2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 47
Sequence identity between the two chains 1.0
PubMed citation 27630019
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID H F
UniProt accession Q05789 Q05789
Species 4932 (Saccharomyces cerevisiae) 4932 (Saccharomyces cerevisiae)
Function annotation BioLiP:5kc1F
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5kc1-a2-m1-cH_5kc1-a2-m1-cF.pdb.gz
Full biological assembly
Download: 5kc1-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5kc1/1/1:D/1:B 5kc1/3/1:J/1:L

[Back to Home]