5kht/2/1:B/1:D

Sequences
>5kht-a2-m1-cB (length=47) [Search sequence]
GMDAIKKKMQMLKLDKENALDRAEQAEADNYHLENEVARLKKLVGER
>5kht-a2-m1-cD (length=47) [Search sequence]
GMDAIKKKMQMLKLDKENALDRAEQAEADNYHLENEVARLKKLVGER
Structure information
PDB ID 5kht (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the N-terminal fragment of tropomyosin isoform Tpm1.1 at 1.5 A resolution
Assembly ID 2
Resolution 1.4964Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 76
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B D
UniProt accession P03069 P03069
Species 559292 (Saccharomyces cerevisiae S288C) 559292 (Saccharomyces cerevisiae S288C)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5kht-a2-m1-cB_5kht-a2-m1-cD.pdb.gz
Full biological assembly
Download: 5kht-assembly2.cif.gz
Similar dimers

[Back to Home]