5ki9/1/1:A/2:A

Sequences
>5ki9-a1-m1-cA (length=40) [Search sequence]
EFELDRICGYGTARCRCRSQEYRIGRCPNTYACCLRWDES
>5ki9-a1-m2-cA (length=40) [Search sequence]
EFELDRICGYGTARCRCRSQEYRIGRCPNTYACCLRWDES
Structure information
PDB ID 5ki9 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of human beta-defensin 4 (HBD4)
Assembly ID 1
Resolution 1.6Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 30
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession Q8WTQ1 Q8WTQ1
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:5ki9A BioLiP:5ki9A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5ki9-a1-m1-cA_5ki9-a1-m2-cA.pdb.gz
Full biological assembly
Download: 5ki9-assembly1.cif.gz

[Back to Home]