5kko/1/2:E/3:C

Sequences
>5kko-a1-m2-cE (length=52) [Search sequence]
NAKYFQIDELTLNALRITTIESLTPEQRLELIKAHLLNIKTPSDDNEPWDEF
>5kko-a1-m3-cC (length=53) [Search sequence]
SNAKYFQIDELTLNALRITTIESLTPEQRLELIKAHLLNIKTPSDDNEPWDEF
Structure information
PDB ID 5kko (database links: RCSB PDB PDBe PDBj PDBsum)
Title A 1.55A X-Ray Structure from Vibrio cholerae O1 biovar El Tor of a Hypothetical Protein
Assembly ID 1
Resolution 1.55Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 26
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 3
Chain ID E C
UniProt accession
Species 666 (Vibrio cholerae) 666 (Vibrio cholerae)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5kko-a1-m2-cE_5kko-a1-m3-cC.pdb.gz
Full biological assembly
Download: 5kko-assembly1.cif.gz

[Back to Home]