5kko/1/3:B/3:C

Sequences

>5kko-a1-m3-cB (length=52) [Search sequence]

SNAKYFQIDELTLNALRITTIESLTPEQRLELIKAHLLNIKTPSDDNEPWDE

>5kko-a1-m3-cC (length=53) [Search sequence]

SNAKYFQIDELTLNALRITTIESLTPEQRLELIKAHLLNIKTPSDDNEPWDEF

Structure information

PDB ID	5kko (database links: RCSB PDB PDBe PDBj PDBsum)
Title	A 1.55A X-Ray Structure from Vibrio cholerae O1 biovar El Tor of a Hypothetical Protein
Assembly ID	1
Resolution	1.55Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	72
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	3	3
Chain ID	B	C
UniProt accession
Species	666 (Vibrio cholerae)	666 (Vibrio cholerae)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 5kko-a1-m3-cB_5kko-a1-m3-cC.pdb.gz

Full biological assembly Download: 5kko-assembly1.cif.gz

Similar dimers