5klf/2/1:A/2:A

Sequences
>5klf-a2-m1-cA (length=92) [Search sequence]
ASCGSGNFNKTAAKGVEFSAVAGDCIKYNKSSGTLQIGSWTGVASSYNITSGPQGITNTG
NGWTTVANAANGDLYIKIVSASRSFNVKFDNW
>5klf-a2-m2-cA (length=92) [Search sequence]
ASCGSGNFNKTAAKGVEFSAVAGDCIKYNKSSGTLQIGSWTGVASSYNITSGPQGITNTG
NGWTTVANAANGDLYIKIVSASRSFNVKFDNW
Structure information
PDB ID 5klf (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of CBM_E1, a novel carbohydrate-binding module found by sugar cane soil metagenome, complexed with cellopentaose and gadolinium ion
Assembly ID 2
Resolution 1.801Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 32
Sequence identity between the two chains 1.0
PubMed citation 27621314
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession A0A0R5P8X1 A0A0R5P8X1
Species 77133 (uncultured bacterium) 77133 (uncultured bacterium)
Function annotation BioLiP:5klfA BioLiP:5klfA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5klf-a2-m1-cA_5klf-a2-m2-cA.pdb.gz
Full biological assembly
Download: 5klf-assembly2.cif.gz

[Back to Home]