5koi/3/1:E/1:H

Sequences

>5koi-a3-m1-cE (length=271) [Search sequence]

EGLMQGKRGLIMGVANNHSLAWGIAKQLAAQGAELAFTYQGDALGKRVKPLAEQVGSDFV
LPCDVEDIATVDAVFEEIEKKWGGLDFLVHAIGFSDKTELKGRYADVTTRENFSRTMVIS
AYSFTEVAQRAEKLMKDGGSILTLTYGGSTRTIPNYNVMGVAKAALEAMVRYLAADYGPQ
GIRVNAISAGPVRTLAGAGIGDARAIFSYQRRNSPLRRTVDIDDVGKSAVYLLSDLSSGV
TGEIHFVDSGYNIVSMPTLEELKSSDSERGE

>5koi-a3-m1-cH (length=271) [Search sequence]

Structure information

PDB ID	5koi (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of a Possible Enoyl-(acyl-carrier-protein) Reductase from Brucella melitensis
Assembly ID	3
Resolution	1.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	104
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	H
UniProt accession	Q57A95	Q57A95
Species	262698 (Brucella abortus bv. 1 str. 9-941)	262698 (Brucella abortus bv. 1 str. 9-941)
Function annotation	BioLiP:5koiE	BioLiP:5koiH

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	5koi-a3-m1-cE_5koi-a3-m1-cH.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	5koi-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures

5koi/1/1:A/1:D 5koi/2/1:C/1:B 5koi/4/1:F/1:G