5l2l/1/1:A/1:B

Sequences

>5l2l-a1-m1-cA (length=72) [Search sequence]

SEKSLEQCKFGTHCTNKRCKYRHARSHIMCREGANCTRIDCLFGHPINEDCRFGVNCKNI YCLFRHPPGRVL

>5l2l-a1-m1-cB (length=74) [Search sequence]

GSEKSLEQCKFGTHCTNKRCKYRHARSHIMCREGANCTRIDCLFGHPINEDCRFGVNCKN IYCLFRHPPGRVLP

Structure information

PDB ID	5l2l (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Nab2 Zn fingers 5-7 bound to A11G RNA
Assembly ID	1
Resolution	1.55Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	10
Sequence identity between the two chains	1.0
PubMed citation	28180315

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	P32505	P32505
Species	1294386 (Saccharomyces cerevisiae YJM1574)	1294386 (Saccharomyces cerevisiae YJM1574)
Function annotation	BioLiP:5l2lA	BioLiP:5l2lB

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5l2l-a1-m1-cA_5l2l-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5l2l-assembly1.cif.gz