5l6l/1/1:E/1:H

Sequences
>5l6l-a1-m1-cE (length=63) [Search sequence]
HHARATGKTFRSGNSEAVRLPRDLAFGADVELTLIRSGDVLTIYPSKGSIADLVATLNQP
RPD
>5l6l-a1-m1-cH (length=80) [Search sequence]
HHHHARATGKTFRSGNSEAVRLPRDLAFGADVELTLIRSGDVLTIYPSKGSIADLVATLN
QPRPDSVEIRDEDLFPERPG
Structure information
PDB ID 5l6l (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of Caulobacter crescentus VapBC1 bound to operator DNA
Assembly ID 1
Resolution 2.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 153
Sequence identity between the two chains 1.0
PubMed citation 27998932
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E H
UniProt accession Q9AC34 Q9AC34
Species 190650 (Caulobacter vibrioides CB15) 190650 (Caulobacter vibrioides CB15)
Function annotation BioLiP:5l6lE BioLiP:5l6lH
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5l6l-a1-m1-cE_5l6l-a1-m1-cH.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 5l6l-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5l6l/1/1:A/1:D 5l6m/1/1:A/1:D

[Back to Home]